PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp6g35770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 315aa    MW: 35473.7 Da    PI: 9.8199
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp6g35770genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.11.4e-31133191260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                +DgynWrKYGqK+vkgse+prsY+rCt+++C +kkkve+s   ++v+ei+Y+g+Hnh+k
  Tp6g35770 133 EDGYNWRKYGQKQVKGSENPRSYFRCTYPNCLTKKKVETSLVKGHVTEIVYKGSHNHPK 191
                7********************************************************85 PP

2WRKY1023.4e-32253311159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg++++rsYYrCt++gC+v+k+ver+ +d k v++tYeg+Hnh+
  Tp6g35770 253 LDDGYRWRKYGQKVVKGNPNSRSYYRCTFTGCCVRKQVERAFQDAKSVITTYEGKHNHH 311
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-26125192IPR003657WRKY domain
PROSITE profilePS5081123.766127192IPR003657WRKY domain
SuperFamilySSF1182904.97E-25128192IPR003657WRKY domain
SMARTSM007745.8E-34132191IPR003657WRKY domain
PfamPF031061.9E-23133190IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-35238313IPR003657WRKY domain
SuperFamilySSF1182903.14E-28245313IPR003657WRKY domain
PROSITE profilePS5081134.819248313IPR003657WRKY domain
SMARTSM007741.3E-36253312IPR003657WRKY domain
PfamPF031062.5E-24254311IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070370Biological Processcellular heat acclimation
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGSFNQQRSV PKFKSATPSP LPLSSFSHYF SMPPGLTHAD LLDSPLLFTS CNILPSPTTG  60
TFPAQSLKRR NNGLLIDRSV IQTEDLKEPF DFSFTTKQTS PLFPSSAVVQ PLPQLDVPKP  120
ESRSSHTSNK TSEDGYNWRK YGQKQVKGSE NPRSYFRCTY PNCLTKKKVE TSLVKGHVTE  180
IVYKGSHNHP KPQCTKRSAS TAATHDLKSH QSSNHGDGQE FGEDEADAKR SKREETVKEP  240
RVVVQTTSDI DILDDGYRWR KYGQKVVKGN PNSRSYYRCT FTGCCVRKQV ERAFQDAKSV  300
ITTYEGKHNH HIPTQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-33133313877Probable WRKY transcription factor 4
1wj2_A6e-33133313877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00494DAPTransfer from AT5G07100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013718836.11e-174PREDICTED: probable WRKY transcription factor 26 isoform X3
RefseqXP_013718835.11e-174PREDICTED: probable WRKY transcription factor 26 isoform X2
RefseqNP_001288922.11e-174probable WRKY transcription factor 26
SwissprotQ9C5T31e-162WRK26_ARATH; Probable WRKY transcription factor 26
TrEMBLA0A078EUW41e-174A0A078EUW4_BRANA; BnaAnng01980D protein
TrEMBLV5REL51e-174V5REL5_BRACM; WRKY transcription factor 26
STRINGBra028707.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM152911518
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07100.11e-163WRKY DNA-binding protein 26